PDB entry 4hsz

View 4hsz on RCSB PDB site
Description: Structure of truncated (delta8C) S100A4
Class: metal binding protein
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, METAL BINDING PROTEIN
Deposited on 2012-10-31, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.231
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hsza_
  • Chain 'B':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hszb_
  • Chain 'C':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hszc_
  • Chain 'D':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hszd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hszA (A:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hszA (A:)
    cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnl
    dsnrdnevdfqeycvflsciammcneffeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hszB (B:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hszB (B:)
    cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnl
    dsnrdnevdfqeycvflsciammcneffeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hszC (C:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hszC (C:)
    cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnl
    dsnrdnevdfqeycvflsciammcneffeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hszD (D:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hszD (D:)
    cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnl
    dsnrdnevdfqeycvflsciammcneffeg