PDB entry 4hsx

View 4hsx on RCSB PDB site
Description: Structure of the L100F mutant of dehaloperoxidase-hemoglobin A from Amphitrite ornata with 4-bromophenol
Class: oxidoreductase
Keywords: Globin, Oxygen Storage, Peroxidase, OXIDOREDUCTASE
Deposited on 2012-10-31, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (99)
    Domains in SCOPe 2.07: d4hsxa_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (99)
    Domains in SCOPe 2.07: d4hsxb_
  • Heterogens: HEM, SO4, GOL, BML, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hsxA (A:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfekffvalveymrasgqsfdsqsw
drfgknlvsalssagmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hsxB (B:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfekffvalveymrasgqsfdsqsw
drfgknlvsalssagmk