PDB entry 4hsv

View 4hsv on RCSB PDB site
Description: Crystal Structure of CXCL4L1
Class: antitumor protein
Keywords: anti-angiogenesis, heparin, extracellular, antitumor protein
Deposited on 2012-10-30, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.238
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Platelet factor 4 variant
    Species: Homo sapiens [TaxId:9606]
    Gene: PF4V1, CXCL4V1, SCYB4V1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hsva_
  • Chain 'B':
    Compound: Platelet factor 4 variant
    Species: Homo sapiens [TaxId:9606]
    Gene: PF4V1, CXCL4V1, SCYB4V1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hsvb_
  • Chain 'C':
    Compound: Platelet factor 4 variant
    Species: Homo sapiens [TaxId:9606]
    Gene: PF4V1, CXCL4V1, SCYB4V1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hsvc_
  • Chain 'D':
    Compound: Platelet factor 4 variant
    Species: Homo sapiens [TaxId:9606]
    Gene: PF4V1, CXCL4V1, SCYB4V1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hsvd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hsvA (A:)
    meaeedgdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqall
    ykkiikehles
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hsvA (A:)
    gdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqallykkiik
    ehles
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hsvB (B:)
    meaeedgdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqall
    ykkiikehles
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hsvB (B:)
    clcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqallykkiikehl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hsvC (C:)
    meaeedgdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqall
    ykkiikehles
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hsvC (C:)
    qclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqallykkiikeh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hsvD (D:)
    meaeedgdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqall
    ykkiikehles
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hsvD (D:)
    gdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqallykkiik
    ehles