PDB entry 4hsj

View 4hsj on RCSB PDB site
Description: 1.88 angstrom x-ray crystal structure of piconlinic-bound 3-hydroxyanthranilate-3,4-dioxygenase
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: bi-cupin, dioxygenase, OXIDOREDUCTASE, Oxidoreductase-Oxidoreductase inhibitor complex
Deposited on 2012-10-30, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-hydroxyanthranilate 3,4-dioxygenase
  Species: Cupriavidus metallidurans [TaxId:266264]
  Gene: nbaC, Ralstonia metallidurans, Rmet_5193
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1LCS4 (0-173)
  Domains in SCOPe 2.07: d4hsja_
• Heterogens: FE2, 6PC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hsjA (A:)
  mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
  qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
  fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa