PDB entry 4hsj

View 4hsj on RCSB PDB site
Description: 1.88 angstrom x-ray crystal structure of piconlinic-bound 3-hydroxyanthranilate-3,4-dioxygenase
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: bi-cupin, dioxygenase, OXIDOREDUCTASE, Oxidoreductase-Oxidoreductase inhibitor complex
Deposited on 2012-10-30, released 2015-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:266264]
    Gene: nbaC, Ralstonia metallidurans, Rmet_5193
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hsja_
  • Heterogens: FE2, 6PC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hsjA (A:)
    mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
    qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
    fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa