PDB entry 4hrx

View 4hrx on RCSB PDB site
Description: Crystal structure of KAI2
Class: hydrolase
Keywords: alpha/beta hydrolase, SIGNALING PROTEIN, HYDROLASE
Deposited on 2012-10-29, released 2013-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.163
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, alpha/beta fold family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g37470, F6G17.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hrxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hrxA (A:)
    hhhhhhlestslykkagfmgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvd
    dyrvvlydnmgagttnpdyfdfdrysnlegysfdliailedlkiescifvghsvsamigv
    laslnrpdlfskivmisaspryvndvdyqggfeqedlnqlfeairsnykawclgfaplav
    ggdmdsiavqefsrtlfnmrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpv
    vvseylhanlgcesvvevipsdghlpqlsspdsvipvilrhirndiam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hrxA (A:)
    vveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdyf
    dfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisasp
    ryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnmr
    pdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevip
    sdghlpqlsspdsvipvilrhirndi