PDB entry 4hrr

View 4hrr on RCSB PDB site
Description: Scapharca tetrameric hemoglobin, CO-state
Class: oxygen transport
Keywords: hemoglobin, oxygen transport, Globin fold, Oxygen
Deposited on 2012-10-28, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.139
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Globin-2 A chain
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14821 (3-148)
      • see remark 999 (0-2)
    Domains in SCOPe 2.07: d4hrra1, d4hrra2
  • Chain 'B':
    Compound: Hemoglobin B chain
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02480 (0-150)
      • see remark 999 (1)
    Domains in SCOPe 2.07: d4hrrb_
  • Chain 'C':
    Compound: Globin-2 A chain
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14821 (3-148)
      • see remark 999 (0-2)
    Domains in SCOPe 2.07: d4hrrc1, d4hrrc2
  • Chain 'D':
    Compound: Hemoglobin B chain
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02480 (0-150)
      • see remark 999 (1)
    Domains in SCOPe 2.07: d4hrrd_
  • Chain 'E':
    Compound: Globin-2 A chain
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14821 (3-148)
      • see remark 999 (0-2)
    Domains in SCOPe 2.07: d4hrre1, d4hrre2
  • Chain 'F':
    Compound: Hemoglobin B chain
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02480 (0-150)
      • see remark 999 (1)
    Domains in SCOPe 2.07: d4hrrf_
  • Chain 'G':
    Compound: Globin-2 A chain
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14821 (3-148)
      • see remark 999 (0-2)
    Domains in SCOPe 2.07: d4hrrg1, d4hrrg2
  • Chain 'H':
    Compound: Hemoglobin B chain
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02480 (Start-150)
      • see remark 999 (1)
    Domains in SCOPe 2.07: d4hrrh_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hrrA (A:)
    vdaavakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkg
    kansklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmke
    tlkarmgnyysddvagawaalvgvvqaal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hrrB (B:)
    srvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvs
    agkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgpl
    rqtlkarmgnyfdedtvaawaslvavvqaal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hrrC (C:)
    vdaavakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkg
    kansklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmke
    tlkarmgnyysddvagawaalvgvvqaal
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hrrD (D:)
    srvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvs
    agkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgpl
    rqtlkarmgnyfdedtvaawaslvavvqaal
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hrrE (E:)
    vdaavakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkg
    kansklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmke
    tlkarmgnyysddvagawaalvgvvqaal
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hrrF (F:)
    srvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvs
    agkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgpl
    rqtlkarmgnyfdedtvaawaslvavvqaal
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hrrG (G:)
    vdaavakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkg
    kansklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmke
    tlkarmgnyysddvagawaalvgvvqaal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4hrrH (H:)
    srvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvs
    agkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgpl
    rqtlkarmgnyfdedtvaawaslvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hrrH (H:)
    rvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvsa
    gkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplr
    qtlkarmgnyfdedtvaawaslvavvqaal