PDB entry 4hqm

View 4hqm on RCSB PDB site
Description: The crystal structure of QsrR-menadione complex
Class: TRANSCRIPTION regulator
Keywords: menadione-modified protein, DNA, TRANSCRIPTION regulator
Deposited on 2012-10-25, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.285
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: QsrR protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3FJN1
      • see remark 999 (32)
      • see remark 999 (35)
    Domains in SCOPe 2.07: d4hqma_
  • Chain 'B':
    Compound: QsrR protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3FJN1
      • see remark 999 (32)
      • see remark 999 (35)
    Domains in SCOPe 2.07: d4hqmb_
  • Heterogens: 17Z

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hqmA (A:)
    snammevcpyleetfkilgrswngliinylsrsndssahfsdmkrdlktitpralslkls
    elaqwelvekqiistspvqiiyvltekgkalaealhpieawaqsyvdltdqrtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hqmA (A:)
    vcpyleetfkilgrswngliinylsrsndssahfsdmkrdlktitpralslklselaqwe
    lvekqiistspvqiiyvltekgkalaealhpieawaqsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hqmB (B:)
    snammevcpyleetfkilgrswngliinylsrsndssahfsdmkrdlktitpralslkls
    elaqwelvekqiistspvqiiyvltekgkalaealhpieawaqsyvdltdqrtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hqmB (B:)
    vcpyleetfkilgrswngliinylsrsndssahfsdmkrdlktitpralslklselaqwe
    lvekqiistspvqiiyvltekgkalaealhpieawaqsyv