PDB entry 4hph

View 4hph on RCSB PDB site
Description: The crystal structure of isomaltulose synthase mutant E295Q from Erwinia rhapontici NX5 in complex with its natural substrate sucrose
Class: isomerase
Keywords: Tim barrel, isomerase, hydrolase, calcium binding
Deposited on 2012-10-23, released 2013-10-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose isomerase
    Species: Erwinia rhapontici [TaxId:55212]
    Gene: PalI
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9MPF2 (0-558)
      • engineered mutation (253)
    Domains in SCOPe 2.03: d4hpha1, d4hpha2
  • Heterogens: CA, GOL, SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hphA (A:)
    nalptwwkqavfyqvyprsfkdtngdgigdlngiienldylkklgidaiwinphydspnt
    dngydirdyrkimkeygtmedfdrlisemkkrnmrlmidivinhtsdqhawfvqsksgkn
    npyrdyyfwrdgkdghapnnypsffggsawekddksgqyylhyfakqqpdlnwdnpkvrq
    dlydmlrfwldkgvsglrfdtvatyskipnfpdlsqqqlknfaeeytkgpkihdyvnemn
    revlshydiatagqifgvpldksikffdrrrnelniaftfdlirldrdaderwrrkdwtl
    sqfrkivdkvdqtageygwnaffldnhdnpravshfgddrpqwrehaakalatltltqra
    tpfiyqgselgmtnypfkkiddfddvevkgfwqdyvetgkvkaeeflqnvrqtsrdnsrt
    pfqwdasknagftsgtpwlkinpnykeinsadqinnpnsvfnyyrklinirhdipaltyg
    syidldpdnnsvyaytrtlgaekylvvinfkeevmhytlpgdlsinkvitennshtivnk
    ndrqlrlepwqsgiyklnp