PDB entry 4hpd

View 4hpd on RCSB PDB site
Description: Crystal structure of Nitrophorin 4 from Rhodnius prolixus Complexed with homocysteine at pH 7.4
Class: transport protein
Keywords: HEME, Lipocalin, Nitrophorin, metal binding protein, TRANSPORT PROTEIN
Deposited on 2012-10-23, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.146
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin-4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
  Domains in SCOPe 2.07: d4hpda_
• Heterogens: HEM, HCS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hpdA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk