PDB entry 4hpb

View 4hpb on RCSB PDB site
Description: Crystal structure of Nitrophorin 4 from Rhodnius prolixus Complexed with Beta-Mercaptoethanol at pH 7.4
Class: transport protein
Keywords: HEME, Lipocalin, Nitrophorin, metal binding protein, TRANSPORT PROTEIN
Deposited on 2012-10-23, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.144
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin-4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hpba_
  • Heterogens: HEM, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hpbA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hpbA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldleprycaalaagtasgklkealyhydpktq
    dtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalihtclhk
    gnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslkslltk