PDB entry 4hpa

View 4hpa on RCSB PDB site
Description: Crystal structure of Nitrophorin 4 from Rhodnius prolixus Complexed with sulfide ion at pH 7.4
Class: transport protein
Keywords: HEME, Lipocalin, Nitrophorin, metal binding protein, sulfide, TRANSPORT PROTEIN
Deposited on 2012-10-23, released 2013-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.136
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin-4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hpaa_
  • Heterogens: HEM, H2S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hpaA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk