PDB entry 4how

View 4how on RCSB PDB site
Description: The crystal structure of isomaltulose synthase from Erwinia rhapontici NX5
Class: isomerase
Keywords: Tim barrel, isomerase, hydrolase, Calcium binding
Deposited on 2012-10-22, released 2013-10-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.161
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose isomerase
    Species: Erwinia rhapontici [TaxId:55212]
    Gene: PalI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4howa1, d4howa2
  • Heterogens: GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4howA (A:)
    mdsqglktavaiflattfsatsyqacsagpdtapsltvqqsnalptwwkqavfyqvyprs
    fkdtngdgigdlngiienldylkklgidaiwinphydspntdngydirdyrkimkeygtm
    edfdrlisemkkrnmrlmidivinhtsdqhawfvqsksgknnpyrdyyfwrdgkdghapn
    nypsffggsawekddksgqyylhyfakqqpdlnwdnpkvrqdlydmlrfwldkgvsglrf
    dtvatyskipnfpdlsqqqlknfaeeytkgpkihdyvnemnrevlshydiatageifgvp
    ldksikffdrrrnelniaftfdlirldrdaderwrrkdwtlsqfrkivdkvdqtageygw
    naffldnhdnpravshfgddrpqwrehaakalatltltqratpfiyqgselgmtnypfkk
    iddfddvevkgfwqdyvetgkvkaeeflqnvrqtsrdnsrtpfqwdasknagftsgtpwl
    kinpnykeinsadqinnpnsvfnyyrklinirhdipaltygsyidldpdnnsvyaytrtl
    gaekylvvinfkeevmhytlpgdlsinkvitennshtivnkndrqlrlepwqsgiyklnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4howA (A:)
    nalptwwkqavfyqvyprsfkdtngdgigdlngiienldylkklgidaiwinphydspnt
    dngydirdyrkimkeygtmedfdrlisemkkrnmrlmidivinhtsdqhawfvqsksgkn
    npyrdyyfwrdgkdghapnnypsffggsawekddksgqyylhyfakqqpdlnwdnpkvrq
    dlydmlrfwldkgvsglrfdtvatyskipnfpdlsqqqlknfaeeytkgpkihdyvnemn
    revlshydiatageifgvpldksikffdrrrnelniaftfdlirldrdaderwrrkdwtl
    sqfrkivdkvdqtageygwnaffldnhdnpravshfgddrpqwrehaakalatltltqra
    tpfiyqgselgmtnypfkkiddfddvevkgfwqdyvetgkvkaeeflqnvrqtsrdnsrt
    pfqwdasknagftsgtpwlkinpnykeinsadqinnpnsvfnyyrklinirhdipaltyg
    syidldpdnnsvyaytrtlgaekylvvinfkeevmhytlpgdlsinkvitennshtivnk
    ndrqlrlepwqsgiyklnp