PDB entry 4hok

View 4hok on RCSB PDB site
Description: crystal structure of apo ck1e
Class: transferase
Keywords: ck1e, kinase, inhibitor, pf 4800567, transferase
Deposited on 2012-10-22, released 2012-11-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: 0.241
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (2-295)
• Chain 'C':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (Start-295)
• Chain 'E':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (2-295)
• Chain 'G':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (2-295)
• Chain 'I':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (2-295)
• Chain 'K':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (2-295)
• Chain 'M':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (Start-295)
• Chain 'O':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (2-295)
• Chain 'Q':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (2-295)
• Chain 'S':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (Start-295)
• Chain 'U':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (2-End)
• Chain 'W':
  Compound: Casein kinase I isoform epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CSNK1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49674 (Start-295)
  Domains in SCOPe 2.02: d4hokw_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'W':
  Sequence, based on SEQRES records: (download)
  

  >4hokW (W:)
  gsmelrvgnkyrlgrkigsgsfgdiylganiasgeevaiklecvktkhpqlhieskfykm
  mqggvgipsikwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
  ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
  yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
  vlckgypsefstylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4hokW (W:)
  elrvgnkyrlgrkigsdiylganiasgeevaiklecvktkhpqlhieskfykmmqggvgi
  psikwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfi
  hrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinth
  lgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgyp
  sefstylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk