PDB entry 4hoa

View 4hoa on RCSB PDB site
Description: Crystal structure of the complex of type 1 ribosome inactivating protein from Momordica Balsamina with B-D-galactopyranosyl-(1-4)-D-glucose at 2.0 A resolution
Class: hydrolase
Keywords: B-D-galactopyranosyl-(1-4)-D-glucose, Ribosome inactivating protein, Complex hydrolase, Ligand binding, Hydrolase
Deposited on 2012-10-22, released 2012-11-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA N-glycosidase
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hoaa_
  • Heterogens: LAT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hoaA (A:)
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni