PDB entry 4hns

View 4hns on RCSB PDB site
Description: Crystal structure of activated CheY3 of Vibrio cholerae
Class: signaling protein
Keywords: Rossmann fold, Response regulator, kinase, BeF3 and Mg+2 bound, SIGNALING PROTEIN
Deposited on 2012-10-21, released 2013-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.231
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_2065
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQD5 (1-123)
      • expression tag (0)
    Domains in SCOPe 2.05: d4hnsa_
  • Heterogens: MG, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hnsA (A:)
    anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
    gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
    kife