PDB entry 4hni

View 4hni on RCSB PDB site
Description: crystal structure of ck1e in complex with PF4800567
Class: transferase/transferase inhibitor
Keywords: ck1e, kinase, inhibitor, PF4800567, transferase-transferase inhibitor complex
Deposited on 2012-10-19, released 2012-11-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.237
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4hnia_
  • Chain 'B':
    Compound: Casein kinase I isoform epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4hnib_
  • Heterogens: 16W, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hniA (A:)
    gsmelrvgnkyrlgrkigsgsfgdiylganiasgeevaiklecvktkhpqlhieskfykm
    mqggvgipsikwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefstylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hniA (A:)
    lrvgnkyrlgrkigsgsfgdiylganiasgeevaiklecvhieskfykmmqggvgipsik
    wcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdv
    kpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgie
    qsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefs
    tylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hniB (B:)
    gsmelrvgnkyrlgrkigsgsfgdiylganiasgeevaiklecvktkhpqlhieskfykm
    mqggvgipsikwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefstylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hniB (B:)
    melrvgnkyrlgrkigsgsfgdiylganiasgeevaiklecveskfykmmqggvgipsik
    wcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdv
    kpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgie
    qsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefs
    tylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml