PDB entry 4hn4

View 4hn4 on RCSB PDB site
Description: Tryptophan synthase in complex with alpha aminoacrylate E(A-A) form and the F9 inhibitor in the alpha site
Class: lyase/lyase inhibitor
Keywords: Lyase, carbon-oxygen lyase, tryptophan biosynthesis, Salmonella, F9F, Allosteric enzyme, Amino-acid biosynthesis, Aromatic amino acid biosynthesis, Pyridoxal phosphate, alpha amino acrylate, LYASE-LYASE INHIBITOR complex
Deposited on 2012-10-18, released 2013-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.15
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: STM1727, trpA, trpA and trpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hn4a_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hn4b_
  • Heterogens: F9F, 0JO, PEG, BCN, CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hn4A (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hn4B (B:)
    mttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptalt
    kcqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasa
    lasallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgs
    yetahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigm
    fadfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysi
    sagldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalk
    mmreqpekeqllvvnlsgrgdkdiftvhdilkargei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn4B (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkarge