PDB entry 4hn1

View 4hn1 on RCSB PDB site
Description: Crystal Structure of H60N/Y130F double mutant of ChmJ, a 3'-monoepimerase from Streptomyces bikiniensis in complex with dTDP
Class: unknown function
Keywords: 3'-monoepimerase, natural product, deoxysugar, chalcomycin, dTDP-mycinose, Cupin fold, nucleotide-linked sugar, Epimerization, UNKNOWN FUNCTION
Deposited on 2012-10-18, released 2012-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.214
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 3-epimerase in D-allose pathway
    Species: Streptomyces bikiniensis [TaxId:1896]
    Gene: chmJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SFD1 (0-195)
      • engineered mutation (59)
      • engineered mutation (129)
      • expression tag (196-198)
    Domains in SCOPe 2.06: d4hn1a1, d4hn1a2
  • Chain 'B':
    Compound: Putative 3-epimerase in D-allose pathway
    Species: Streptomyces bikiniensis [TaxId:1896]
    Gene: chmJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SFD1 (0-195)
      • engineered mutation (59)
      • engineered mutation (129)
      • expression tag (196-198)
    Domains in SCOPe 2.06: d4hn1b1, d4hn1b2
  • Chain 'C':
    Compound: Putative 3-epimerase in D-allose pathway
    Species: Streptomyces bikiniensis [TaxId:1896]
    Gene: chmJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SFD1 (0-195)
      • engineered mutation (59)
      • engineered mutation (129)
      • expression tag (196-200)
    Domains in SCOPe 2.06: d4hn1c1, d4hn1c2
  • Chain 'D':
    Compound: Putative 3-epimerase in D-allose pathway
    Species: Streptomyces bikiniensis [TaxId:1896]
    Gene: chmJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SFD1 (0-195)
      • engineered mutation (59)
      • engineered mutation (129)
      • expression tag (196-199)
    Domains in SCOPe 2.06: d4hn1d1, d4hn1d2
  • Heterogens: EDO, TYD, THM, TDR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hn1A (A:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrlehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn1A (A:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hn1B (B:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrlehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn1B (B:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrleh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hn1C (C:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrlehhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hn1D (D:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrlehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn1D (D:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrlehh