PDB entry 4hn0

View 4hn0 on RCSB PDB site
Description: Crystal Structure of ChmJ, a 3'-monoepimerase apoenzyme from Streptomyces bikiniensis
Class: unknown function
Keywords: 3'-monoepimerase, natural product, deoxysugar, chalcomycin, dTDP-mycinose, Cupin fold, nucleotide-linked sugar, Epimerization, UNKNOWN FUNCTION
Deposited on 2012-10-18, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 3-epimerase in D-allose pathway
    Species: Streptomyces bikiniensis [TaxId:1896]
    Gene: chmJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SFD1 (0-195)
      • expression tag (196-197)
    Domains in SCOPe 2.07: d4hn0a1, d4hn0a2
  • Chain 'B':
    Compound: Putative 3-epimerase in D-allose pathway
    Species: Streptomyces bikiniensis [TaxId:1896]
    Gene: chmJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SFD1 (0-195)
      • expression tag (196-197)
    Domains in SCOPe 2.07: d4hn0b1, d4hn0b2
  • Chain 'C':
    Compound: Putative 3-epimerase in D-allose pathway
    Species: Streptomyces bikiniensis [TaxId:1896]
    Gene: chmJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SFD1 (0-195)
      • expression tag (196-197)
    Domains in SCOPe 2.07: d4hn0c1, d4hn0c2
  • Chain 'D':
    Compound: Putative 3-epimerase in D-allose pathway
    Species: Streptomyces bikiniensis [TaxId:1896]
    Gene: chmJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SFD1 (0-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d4hn0d1, d4hn0d2
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hn0A (A:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hn0B (B:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hn0C (C:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hn0D (D:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn0D (D:)
    mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih
    yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
    sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
    llptyqawqeqqqaqrl