PDB entry 4hmj

View 4hmj on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, ionizable group, HYDROLASE
Deposited on 2012-10-18, released 2012-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.181
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (35)
      • engineered mutation (43-44)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.03: d4hmja_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hmjA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrdllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hmjA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrdllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws