PDB entry 4hma

View 4hma on RCSB PDB site
Description: Crystal structure of an MMP twin carboxylate based inhibitor LC20 in complex with the MMP-9 catalytic domain
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HYDROLASE/TWIN INHIBITOR, Zincin-like, Gelatinase, Collagenase (Catalytic Domain), Hydrolase-Hydrolase Inhibitor complex
Deposited on 2012-10-18, released 2013-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Matrix metalloproteinase-9
  Species: Homo sapiens [TaxId:9606]
  Gene: CLG4B, MMP9
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14780 (0-104)
  • Uniprot P14780 (106-159)
    • engineered mutation (117)
  Domains in SCOPe 2.06: d4hmaa_
• Chain 'B':
  Compound: Matrix metalloproteinase-9
  Species: Homo sapiens [TaxId:9606]
  Gene: CLG4B, MMP9
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14780 (0-104)
  • Uniprot P14780 (106-159)
    • engineered mutation (117)
  Domains in SCOPe 2.06: d4hmab_
• Heterogens: ZN, CA, 0ZD, GOL, PGO, PEG, MLT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hmaA (A:)
  fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
  fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
  halgldhssvpealmypmyrftegpplhkddvngirhlyg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hmaB (B:)
  fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
  fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
  halgldhssvpealmypmyrftegpplhkddvngirhlyg