PDB entry 4hlz

View 4hlz on RCSB PDB site
Description: Crystal Structure of Fab C179 in Complex with a H2N2 influenza virus hemagglutinin
Class: viral protein/immune system
Keywords: neutralizing antibodies, antibody affinity, antigens, epitopes, glycosylation, hemagglutinin glycoproteins, immunoglobulin Fab fragments, H2N2 subtype, influenza vaccines, avian flu, envelope protein, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-10-17, released 2013-04-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:387161]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7S226 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4hlza_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:387161]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:387161]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7S226 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4hlzc_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:387161]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:387161]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7S226 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4hlze_
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:387161]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Fab C179 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HLZ (0-End)
  • Chain 'H':
    Compound: Fab C179 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HLZ (0-End)
    Domains in SCOPe 2.03: d4hlzh1, d4hlzh2
  • Chain 'I':
    Compound: Fab C179 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HLZ
  • Chain 'J':
    Compound: Fab C179 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HLZ (0-End)
    Domains in SCOPe 2.03: d4hlzj1, d4hlzj2
  • Chain 'K':
    Compound: Fab C179 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HLZ (0-End)
  • Chain 'L':
    Compound: Fab C179 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HLZ (0-End)
    Domains in SCOPe 2.03: d4hlzl1, d4hlzl2
  • Heterogens: NAG, SO4, EDO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hlzA (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hlzA (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqi
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hlzC (C:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hlzC (C:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqi
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4hlzE (E:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hlzE (E:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqi
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4hlzH (H:)
    diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
    rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hlzH (H:)
    diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
    rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4hlzJ (J:)
    diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
    rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hlzJ (J:)
    diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
    rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hlzL (L:)
    diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
    rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hlzL (L:)
    diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
    rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkngvlnswtdqdskdstysmsstltltkdeye
    rhnsytceathktstspivksfnrn