PDB entry 4hl0

View 4hl0 on RCSB PDB site
Description: Crystal structure of full-length Toxascaris leonina galectin
Class: sugar binding protein
Keywords: Carbohydrate Recognition Domain, Galectin, a regulatory molecule, the host immune system, SUGAR BINDING PROTEIN
Deposited on 2012-10-15, released 2013-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.254
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HL0 (0-277)
    Domains in SCOPe 2.05: d4hl0a1, d4hl0a2
  • Chain 'B':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HL0 (0-277)
    Domains in SCOPe 2.05: d4hl0b1, d4hl0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hl0A (A:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hl0B (B:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv