PDB entry 4hkw

View 4hkw on RCSB PDB site
Description: Crystal Structures of Mutant Endo-beta-1,4-xylanase II Complexed with Substrate and Products
Class: hydrolase
Keywords: xylanase II, xylopentaose, induced fit mechanism, oxocarbenium ion, glycosidase, HYDROLASE
Deposited on 2012-10-15, released 2014-01-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.159
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Endo-1,4-beta-xylanase 2
  Species: TRICHODERMA REESEI [TaxId:51453]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36217 (1-189)
    • expression tag (0)
  Domains in SCOPe 2.04: d4hkwa_
• Heterogens: TRS, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hkwA (A:)
  etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
  nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
  qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
  ssgsasitvs