PDB entry 4hkv

View 4hkv on RCSB PDB site
Description: Naphthalene 1,2-Dioxygenase bound to benzamide
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: Oxidoreductase-Oxidoreductase inhibitor complex
Deposited on 2012-10-15, released 2013-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Naphthalene 1,2-dioxygenase subunit alpha
    Species: Pseudomonas sp. C18 [TaxId:69011]
    Gene: doxB, NC_004999.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hkva1, d4hkva2
  • Chain 'B':
    Compound: Naphthalene 1,2-dioxygenase subunit beta
    Species: Pseudomonas sp. C18 [TaxId:69011]
    Gene: doxD, NC_004999.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hkvb_
  • Heterogens: EDO, SO4, FES, FE, UNU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hkvA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hkvA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hkvB (B:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hkvB (B:)
    iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
    qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
    vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
    rilqthnlmvfl