PDB entry 4hk8

View 4hk8 on RCSB PDB site
Description: Crystal Structures of Mutant Endo- -1,4-xylanase II Complexed with substrate (1.15 A) and Products (1.6 A)
Class: hydrolase
Keywords: xylanase II, xylohexaose, xylotriose, induced fit mechanism, oxocarbenium ion, palm-hand motif, HYDROLASE
Deposited on 2012-10-15, released 2014-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: TRICHODERMA REESEI [TaxId:51453]
    Gene: xyn2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36217 (0-188)
      • engineered mutation (175)
    Domains in SCOPe 2.08: d4hk8a_
  • Heterogens: GOL, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hk8A (A:)
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgyfs
sgsasitvs