PDB entry 4hk2

View 4hk2 on RCSB PDB site
Description: U7Ub25.2540
Class: SIGNALING PROTEIN/Inhibitor
Keywords: Computationally designed ubiquitin, USP7, SIGNALING PROTEIN-Inhibitor complex
Deposited on 2012-10-14, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.199
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC, Ubiquitin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (2-End)
      • expression tag (0-1)
      • engineered mutation (8-9)
      • engineered mutation (14)
      • conflict (35)
      • engineered mutation (43)
      • engineered mutation (50)
      • conflict (69)
      • engineered mutation (70)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d4hk2a1, d4hk2a2
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC, Ubiquitin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (2-End)
      • expression tag (0-1)
      • engineered mutation (8-9)
      • engineered mutation (14)
      • conflict (35)
      • engineered mutation (43)
      • engineered mutation (50)
      • conflict (69)
      • engineered mutation (70)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d4hk2b1, d4hk2b2
  • Chain 'C':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC, Ubiquitin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (2-End)
      • expression tag (0-1)
      • engineered mutation (8-9)
      • engineered mutation (14)
      • conflict (35)
      • engineered mutation (43)
      • engineered mutation (50)
      • conflict (69)
      • engineered mutation (70)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d4hk2c1, d4hk2c2
  • Chain 'D':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC, Ubiquitin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (2-End)
      • expression tag (0-1)
      • engineered mutation (8-9)
      • engineered mutation (14)
      • conflict (35)
      • engineered mutation (43)
      • engineered mutation (50)
      • conflict (69)
      • engineered mutation (70)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d4hk2d1, d4hk2d2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hk2A (A:)
    gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
    yniqkestlrgvrrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hk2A (A:)
    gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
    yniqkestlrgvrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hk2B (B:)
    gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
    yniqkestlrgvrrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hk2B (B:)
    gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
    yniqkestlrgvrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hk2C (C:)
    gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
    yniqkestlrgvrrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hk2C (C:)
    gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
    yniqkestlrgvrrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hk2D (D:)
    gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
    yniqkestlrgvrrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hk2D (D:)
    gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
    yniqkestlrgvrrlr