PDB entry 4hju

View 4hju on RCSB PDB site
Description: Transthyretin in complex with (E)-N-(3-(4-hydroxy-3,5-dimethylstyryl)phenyl)acrylamide
Class: hormone binding protein/inhibitor
Keywords: HORMONE BINDING PROTEIN, Thyroxine, retinol binding protein, HORMONE BINDING PROTEIN-INHIBITOR complex
Deposited on 2012-10-14, released 2013-12-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.171
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4hjua_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4hjub_
  • Heterogens: 16L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hjuA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjuA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hjuB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjuB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn