PDB entry 4hjo

View 4hjo on RCSB PDB site
Description: Crystal structure of the inactive EGFR tyrosine kinase domain with erlotinib
Class: transferase/transferase inhibitor
Keywords: Inactive Tyrosine Kinase Domain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-10-13, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.231
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (262)
    Domains in SCOPe 2.07: d4hjoa_
  • Heterogens: AQ4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hjoA (A:)
    mkkghhhhhggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaik
    elreatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvreh
    kdnigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgae
    ekeyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseiss
    ilekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgde
    rmhlpsptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjoA (A:)
    llrilketefkkikvlgsgafgtvykglwipvkipvaikelreatspkankeildeayvm
    asvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmn
    yledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesi
    lhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymi
    mrkcwmidadsrpkfreliiefskmardpqrylviqgd