PDB entry 4hjk

View 4hjk on RCSB PDB site
Description: U7Ub7 Disulfide variant
Class: SIGNALING PROTEIN/Inhibitor
Keywords: USP7, cytoplasmic,, SIGNALING PROTEIN-Inhibitor complex
Deposited on 2012-10-12, released 2012-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp434K0435, Ubiquitin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UFQ0 (1-76)
      • expression tag (0)
      • engineered mutation (7)
      • engineered mutation (13)
      • engineered mutation (34)
      • conflict (36)
      • engineered mutation (69)
      • engineered mutation (71)
    Domains in SCOPe 2.08: d4hjka1, d4hjka2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hjkA (A:)
    amqifvkcltgktntlevepsdtienvkakiqdkigyppdqqrlifagkqledgrtlsdy
    niqkestlhcvrrlrgg