PDB entry 4hj2

View 4hj2 on RCSB PDB site
Description: Crystal Structure Analysis of GSTA1-1 in complex with chlorambucil
Class: transferase
Keywords: alpha-beta, TRANSFERASE
Deposited on 2012-10-12, released 2013-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hj2a1, d4hj2a2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hj2b1, d4hj2b2
  • Heterogens: LZ6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hj2A (A:)
    kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleearkif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hj2B (B:)
    kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleearkif
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hj2B (B:)
    kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvekdaklalikek
    iknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllkalktr
    isnlptvkkflqpgsprkppmdeksleearkif