PDB entry 4hiz

View 4hiz on RCSB PDB site
Description: Phage phi92 endosialidase
Class: hydrolase,viral protein
Keywords: sialidase fold; beta-helix, endo-alpha2,8-sialidase; endo-alpha2,9-sialidase, Sialic acid polymer, HYDROLASE,VIRAL PROTEIN
Deposited on 2012-10-12, released 2014-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.107
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endosialidase
    Species: Enterobacteria phage phi92 [TaxId:948870]
    Gene: gene 143, PHI92_gene_143
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hiza1, d4hiza2
  • Chain 'B':
    Compound: Endosialidase
    Species: Enterobacteria phage phi92 [TaxId:948870]
    Gene: gene 143, PHI92_gene_143
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hizb1, d4hizb2
  • Chain 'C':
    Compound: Endosialidase
    Species: Enterobacteria phage phi92 [TaxId:948870]
    Gene: gene 143, PHI92_gene_143
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hizc1, d4hizc2
  • Heterogens: SUC, EDO, MG, CL, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hizA (A:)
    gsavgdgatddtnaitqllaampdgwiidgrnltfkvttlpdiskfknaafvyerivgqp
    ltyvsegffdgnltkitdtpfynawtqdktfvydnviyapfmagerhgvqnlhvawvksg
    ddgqtwsmpewltpihpdytadkvnyhcmsmgvcgnrlyavietrylsnmrlkkaelwsr
    pmpyyrrptggitissgsttativlkkhglkvgdavnfsnsgatgvsgnmtvasvinkdt
    ftvtlaraatsnidntgttwhfgtrfwdspweitelpdvaystnadlcvtethsftvidd
    dnytfavgyhngdisprrlgilyfnnaysdpssftrrtisqeyadnaaepcikyydgily
    lttrgtstsaagstlamsadlgenwnylrfpnnvhhtnlpfakvgdylyifgtersfgew
    egqeldnrykgtyprtfmckinvsswpvslsnvqwfnitdqiyqghivnsacgvgsvcvk
    dgwlyyifggedflspwsigdnskklwykhdghpadlysyrlkitehdfvsrdfkygatp
    nrtlpvsmgtdgvrhvsapvtfdndvqmysltvtglehdgtqqsavrvkldgdygviakn
    ipiknpseqrlilcggetpyttdgsllqlygsnhtypnrailyapggaytqnnfmpyldg
    qvslggasnrwsevyastgtint
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hizA (A:)
    wiidgrnltfkvttlpdiskfknaafvyerivgqpltyvsegffdgnltkitdtpfynaw
    tqdktfvydnviyapfmagerhgvqnlhvawvksgddgqtwsmpewltpihpdytadkvn
    yhcmsmgvcgnrlyavietrylsnmrlkkaelwsrpmpyyrrptggitissgsttativl
    kkhglkvgdavnfsnsgatgvsgnmtvasvinkdtftvtlaraatsnidntgttwhfgtr
    fwdspweitelpdvaystnadlcvtethsftvidddnytfavgyhngdisprrlgilyfn
    naysdpssftrrtisqeyadnaaepcikyydgilylttrgtstsaagstlamsadlgenw
    nylrfpnnvhhtnlpfakvgdylyifgtersfgewegqeldnrykgtyprtfmckinvss
    wpvslsnvqwfnitdqiyqghivnsacgvgsvcvkdgwlyyifggedflspwsigdnskk
    lwykhdghpadlysyrlkitehdfvsrdfkygatpnrtlpvsmgtdgvrhvsapvtfdnd
    vqmysltvtglehdgtqqsavrvkldgdygviaknipiknpseqrlilcggetpyttdgs
    llqlygsnhtypnrailyapggaytqnnfmpyldgqvslggasnrwsevyastgtint
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hizB (B:)
    gsavgdgatddtnaitqllaampdgwiidgrnltfkvttlpdiskfknaafvyerivgqp
    ltyvsegffdgnltkitdtpfynawtqdktfvydnviyapfmagerhgvqnlhvawvksg
    ddgqtwsmpewltpihpdytadkvnyhcmsmgvcgnrlyavietrylsnmrlkkaelwsr
    pmpyyrrptggitissgsttativlkkhglkvgdavnfsnsgatgvsgnmtvasvinkdt
    ftvtlaraatsnidntgttwhfgtrfwdspweitelpdvaystnadlcvtethsftvidd
    dnytfavgyhngdisprrlgilyfnnaysdpssftrrtisqeyadnaaepcikyydgily
    lttrgtstsaagstlamsadlgenwnylrfpnnvhhtnlpfakvgdylyifgtersfgew
    egqeldnrykgtyprtfmckinvsswpvslsnvqwfnitdqiyqghivnsacgvgsvcvk
    dgwlyyifggedflspwsigdnskklwykhdghpadlysyrlkitehdfvsrdfkygatp
    nrtlpvsmgtdgvrhvsapvtfdndvqmysltvtglehdgtqqsavrvkldgdygviakn
    ipiknpseqrlilcggetpyttdgsllqlygsnhtypnrailyapggaytqnnfmpyldg
    qvslggasnrwsevyastgtint
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hizB (B:)
    nltfkvttlpdiskfknaafvyerivgqpltyvsegffdgnltkitdtpfynawtqdktf
    vydnviyapfmagerhgvqnlhvawvksgddgqtwsmpewltpihpdytadkvnyhcmsm
    gvcgnrlyavietrylsnmrlkkaelwsrpmpyyrrptggitissgsttativlkkhglk
    vgdavnfsnsgatgvsgnmtvasvinkdtftvtlaraatsnidntgttwhfgtrfwdspw
    eitelpdvaystnadlcvtethsftvidddnytfavgyhngdisprrlgilyfnnaysdp
    ssftrrtisqeyadnaaepcikyydgilylttrgtstsaagstlamsadlgenwnylrfp
    nnvhhtnlpfakvgdylyifgtersfgewegqeldnrykgtyprtfmckinvsswpvsls
    nvqwfnitdqiyqghivnsacgvgsvcvkdgwlyyifggedflspwsigdnskklwykhd
    ghpadlysyrlkitehdfvsrdfkygatpnrtlpvsmgtdgvrhvsapvtfdndvqmysl
    tvtglehdgtqqsavrvkldgdygviaknipiknpseqrlilcggetpyttdgsllqlyg
    snhtypnrailyapggaytqnnfmpyldgqvslggasnrwsevyastgtint
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hizC (C:)
    gsavgdgatddtnaitqllaampdgwiidgrnltfkvttlpdiskfknaafvyerivgqp
    ltyvsegffdgnltkitdtpfynawtqdktfvydnviyapfmagerhgvqnlhvawvksg
    ddgqtwsmpewltpihpdytadkvnyhcmsmgvcgnrlyavietrylsnmrlkkaelwsr
    pmpyyrrptggitissgsttativlkkhglkvgdavnfsnsgatgvsgnmtvasvinkdt
    ftvtlaraatsnidntgttwhfgtrfwdspweitelpdvaystnadlcvtethsftvidd
    dnytfavgyhngdisprrlgilyfnnaysdpssftrrtisqeyadnaaepcikyydgily
    lttrgtstsaagstlamsadlgenwnylrfpnnvhhtnlpfakvgdylyifgtersfgew
    egqeldnrykgtyprtfmckinvsswpvslsnvqwfnitdqiyqghivnsacgvgsvcvk
    dgwlyyifggedflspwsigdnskklwykhdghpadlysyrlkitehdfvsrdfkygatp
    nrtlpvsmgtdgvrhvsapvtfdndvqmysltvtglehdgtqqsavrvkldgdygviakn
    ipiknpseqrlilcggetpyttdgsllqlygsnhtypnrailyapggaytqnnfmpyldg
    qvslggasnrwsevyastgtint
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hizC (C:)
    dgrnltfkvttlpdiskfknaafvyerivgqpltyvsegffdgnltkitdtpfynawtqd
    ktfvydnviyapfmagerhgvqnlhvawvksgddgqtwsmpewltpihpdytadkvnyhc
    msmgvcgnrlyavietrylsnmrlkkaelwsrpmpyyrrptggitissgsttativlkkh
    glkvgdavnfsnsgatgvsgnmtvasvinkdtftvtlaraatsnidntgttwhfgtrfwd
    spweitelpdvaystnadlcvtethsftvidddnytfavgyhngdisprrlgilyfnnay
    sdpssftrrtisqeyadnaaepcikyydgilylttrgtstsaagstlamsadlgenwnyl
    rfpnnvhhtnlpfakvgdylyifgtersfgewegqeldnrykgtyprtfmckinvsswpv
    slsnvqwfnitdqiyqghivnsacgvgsvcvkdgwlyyifggedflspwsigdnskklwy
    khdghpadlysyrlkitehdfvsrdfkygatpnrtlpvsmgtdgvrhvsapvtfdndvqm
    ysltvtglehdgtqqsavrvkldgdygviaknipiknpseqrlilcggetpyttdgsllq
    lygsnhtypnrailyapggaytqnnfmpyldgqvslggasnrwsevyastgtint