PDB entry 4his

View 4his on RCSB PDB site
Description: The Structure of V122I Mutant Transthyretin in Complex with Tafamidis
Class: hormone binding protein/inhibitor
Keywords: THYROID HORMONE TRANSPORT, Thyroxine, Retinol Binding Protein, HORMONE BINDING PROTEIN-INHIBITOR complex
Deposited on 2012-10-11, released 2013-06-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.154
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (121)
    Domains in SCOPe 2.03: d4hisa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (121)
    Domains in SCOPe 2.03: d4hisb_
  • Heterogens: 3MI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hisA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vitnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hisA (A:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavitnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hisB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vitnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hisB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavitn