PDB entry 4hin

View 4hin on RCSB PDB site
Description: 2.4A Resolution Structure of Bovine Cytochrome b5 (S71L)
Class: electron transport
Keywords: cytochrome b5, heme, electron transport
Deposited on 2012-10-11, released 2013-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Gene: CYB5A, CYB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (Start-81)
      • engineered mutation (68)
    Domains in SCOPe 2.08: d4hina_
  • Chain 'B':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Gene: CYB5A, CYB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered mutation (68)
    Domains in SCOPe 2.08: d4hinb_
  • Chain 'C':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Gene: CYB5A, CYB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered mutation (68)
    Domains in SCOPe 2.08: d4hinc_
  • Chain 'D':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Gene: CYB5A, CYB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered mutation (68)
    Domains in SCOPe 2.08: d4hind_
  • Heterogens: HEM, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4hinA (A:)
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
hstdarellktfiigelhpddr

    Sequence, based on observed residues (ATOM records): (download) 
    >4hinA (A:)
vkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvgh
stdarellktfiigelhpddr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hinB (B:)
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
hstdarellktfiigelhpddr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hinC (C:)
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
hstdarellktfiigelhpddr

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hinD (D:)
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
hstdarellktfiigelhpddr