PDB entry 4hi9

View 4hi9 on RCSB PDB site
Description: 1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1 domain collected at wavelength 0.91974
Class: signaling protein
Keywords: ANKYRIN REPEAT LIM DOMAIN, SIGNALING PROTEIN-SIGNALING PROTEIN COMPLEX, ILK-PINCH, Focal adhesion, SIGNALING PROTEIN
Deposited on 2012-10-11, released 2013-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.176
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin-linked protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: ILK, ILK1, ILK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hi9a_
  • Chain 'B':
    Compound: LIM and senescent cell antigen-like-containing domain protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: LIMS1, PINCH, PINCH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48059 (9-71)
      • expression tag (0-8)
  • Heterogens: PO4, IOD, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hi9A (A:)
    gspefmddiftqcregnavavrlwldntendlnqgddhgfsplhwacregrsavvemlim
    rgarinvmnrgddtplhlaashghrdivqkllqykadinavnehgnvplhyacfwgqdqv
    aedlvangalvsicnkygempvdkakaplrellreraekmgqnlnripykdtfwkgttr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hi9A (A:)
    diftqcregnavavrlwldntendlnqgddhgfsplhwacregrsavvemlimrgarinv
    mnrgddtplhlaashghrdivqkllqykadinavnehgnvplhyacfwgqdqvaedlvan
    galvsicnkygempvdkakaplrellreraekmgqnlnripykdtfwk
    

  • Chain 'B':
    No sequence available.