PDB entry 4hhp

View 4hhp on RCSB PDB site
Description: Crystal structure of triosephosphate isomerase from trypanosoma cruzi, mutant e105d
Class: isomerase
Keywords: Tim barrel, ISOMERASE, DISEASE MUTATION, PENTOSE SHUNT, GLUCONEOGENESIS, GLYCOLYSIS
Deposited on 2012-10-10, released 2013-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52270 (Start-250)
      • engineered mutation (104)
    Domains in SCOPe 2.06: d4hhpa_
  • Chain 'B':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52270 (Start-250)
      • engineered mutation (104)
    Domains in SCOPe 2.06: d4hhpb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hhpA (A:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygdtneivaekvaqacaa
    gfhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvat
    pqqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslk
    pefveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hhpA (A:)
    skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq
    iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygdtneivaekvaqacaagf
    hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
    qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
    fveiieatk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hhpB (B:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygdtneivaekvaqacaa
    gfhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvat
    pqqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslk
    pefveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hhpB (B:)
    askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
    qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygdtneivaekvaqacaag
    fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
    qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
    efveiieatk