PDB entry 4hhh

View 4hhh on RCSB PDB site
Description: Structure of Pisum sativum Rubisco
Class: lyase
Keywords: rubisco, ribulose-1,5-bisphosphate, LYASE
Deposited on 2012-10-09, released 2012-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hhha1, d4hhha2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hhhb1, d4hhhb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hhhc1, d4hhhc2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hhhd1, d4hhhd2
  • Chain 'S':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HHH (0-122)
    Domains in SCOPe 2.05: d4hhhs_
  • Chain 'T':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HHH (0-122)
    Domains in SCOPe 2.05: d4hhht_
  • Chain 'U':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HHH (0-122)
    Domains in SCOPe 2.05: d4hhhu_
  • Chain 'V':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HHH (0-122)
    Domains in SCOPe 2.05: d4hhhv_
  • Heterogens: RUB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hhhA (A:)
    mspqtetkakvgfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghyl
    natagtceemlkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsr
    giyftqdwvslpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregnaiireackwspelaaacevwkeikfefpamdtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hhhA (A:)
    gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceeml
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvsl
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregnaiireackwspelaaacevwkeikfef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hhhB (B:)
    mspqtetkakvgfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghyl
    natagtceemlkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsr
    giyftqdwvslpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregnaiireackwspelaaacevwkeikfefpamdtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hhhB (B:)
    gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceeml
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvsl
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregnaiireackwspelaaacevwkeikfef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hhhC (C:)
    mspqtetkakvgfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghyl
    natagtceemlkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsr
    giyftqdwvslpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregnaiireackwspelaaacevwkeikfefpamdtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hhhC (C:)
    gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceeml
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvsl
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregnaiireackwspelaaacevwkeikfef
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hhhD (D:)
    mspqtetkakvgfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghyl
    natagtceemlkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsr
    giyftqdwvslpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregnaiireackwspelaaacevwkeikfefpamdtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hhhD (D:)
    gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceeml
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvsl
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregnaiireackwspelaaacevwkeikfef
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hhhS (S:)
    mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
    yydgrywtmwklpmfgttdpaqvlkeldevkkeyprafvrvigfnnvrqvqcisfiahtp
    esy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hhhT (T:)
    mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
    yydgrywtmwklpmfgttdpaqvlkeldevkkeyprafvrvigfnnvrqvqcisfiahtp
    esy
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hhhU (U:)
    mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
    yydgrywtmwklpmfgttdpaqvlkeldevkkeyprafvrvigfnnvrqvqcisfiahtp
    esy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hhhV (V:)
    mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
    yydgrywtmwklpmfgttdpaqvlkeldevkkeyprafvrvigfnnvrqvqcisfiahtp
    esy