PDB entry 4hhg

View 4hhg on RCSB PDB site
Description: Crystal structure of the Pseudomonas aeruginosa azurin, RuH107NO YOH109
Class: electron transport
Keywords: Greek key, Electron Transfer, Nitrosylated, ELECTRON TRANSPORT
Deposited on 2012-10-09, released 2012-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.235
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (47)
      • engineered mutation (71)
      • conflict (104)
      • engineered mutation (106-108)
    Domains in SCOPe 2.08: d4hhga_
  • Heterogens: CU, DRU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hhgA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdflkpddsrviahtkligsgekdsvtfdvsklkeeehfyffctfpghsal
    mkgtltlk