PDB entry 4hgt

View 4hgt on RCSB PDB site
Description: Crystal structure of ck1d with compound 13
Class: transferase/transferase inhibitor
Keywords: ck1d, kinase, inhibitor, transferase-transferase inhibitor complex
Deposited on 2012-10-08, released 2012-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.24
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hgta_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hgtb_
  • Heterogens: 15G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hgtA (A:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgtA (A:)
    yrlgrkigsgsfgdiylgtdiaageevaiklecvhpqlhieskiykmmqggvgiptirwc
    gaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvkp
    dnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieqs
    rrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefaty
    lnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hgtB (B:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgtB (B:)
    elrvgnryrlgrkidiylgtdiaageevaiklecvqlhieskiykmmqggvgiptirwcg
    aegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvkpd
    nflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieqsr
    rddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatyl
    nfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnm