PDB entry 4hgs

View 4hgs on RCSB PDB site
Description: Crystal structure of ck1gs with compound 13
Class: transferase/transferase inhibitor
Keywords: ck1g, kinase, inhibitor, transferase-transferase inhibitor complex
Deposited on 2012-10-08, released 2012-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.25
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I isoform gamma-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1G3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6M4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d4hgsa_
  • Heterogens: 15G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hgsA (A:)
    gsgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
    lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
    vhsknliyrdvkpenfligrpgnktqqvihiidfglakeyidpetkkhipyrehksltgt
    arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
    ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
    pvgavqqdpalssnreahqhrdkmqqsknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgsA (A:)
    gsgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
    lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
    vhsknliyrdvkpenfligrpgnktqqvihiidfglakeyidpetkkhipyrehksltgt
    arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
    ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
    pv