PDB entry 4hgr

View 4hgr on RCSB PDB site
Description: Crystal structure of E56A/K67A mutant of 2-keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate phosphohydrolase from Bacteroides thetaiotaomicron
Class: Transferase, Hydrolase
Keywords: Rossmann Fold, Phosphohydroylase, Transferase, Hydrolase
Deposited on 2012-10-08, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-End)
      • engineered mutation (55)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hgra_
  • Chain 'B':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (Start-163)
      • engineered mutation (55)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hgrb_
  • Chain 'C':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-End)
      • engineered mutation (55)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hgrc_
  • Chain 'D':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (Start-163)
      • engineered mutation (55)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hgrd_
  • Chain 'E':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-163)
      • engineered mutation (55)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hgre_
  • Chain 'F':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712
      • engineered mutation (55)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hgrf_
  • Chain 'G':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712 (0-End)
      • engineered mutation (55)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hgrg_
  • Chain 'H':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A712
      • engineered mutation (55)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hgrh_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hgrA (A:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgrA (A:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiavi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hgrB (B:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgrB (B:)
    keikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgakteiv
    rrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvpa
    sapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hgrC (C:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgrC (C:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hgrD (D:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgrD (D:)
    keikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgakteiv
    rrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvpa
    sapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hgrE (E:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4hgrF (F:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgrF (F:)
    keikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgakteiv
    rrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvpa
    sapfyirrlstiflekrggegvfrefvekvlginledfiavi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4hgrG (G:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgrG (G:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiavi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4hgrH (H:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgaktei
    vrrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgrH (H:)
    keikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgakteiv
    rrraealkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvpa
    sapfyirrlstiflekrggegvfrefvekvlginledfiavi