PDB entry 4hgo

View 4hgo on RCSB PDB site
Description: 2-keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate phosphohydrolase from Bacteroides thetaiotaomicron in complex with transition state mimic
Class: Transferase, Hydrolase
Keywords: Rossmann Fold, Phosphohydroylase, Transferase, Hydrolase
Deposited on 2012-10-08, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hgoa_
  • Chain 'B':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hgob_
  • Chain 'C':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hgoc_
  • Chain 'D':
    Compound: Acylneuraminate cytidylyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hgod_
  • Heterogens: MG, VN4, KDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hgoA (A:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgoA (A:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiavi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hgoB (B:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgoB (B:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiavi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hgoC (C:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgoC (C:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiavi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hgoD (D:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgoD (D:)
    keikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgekteiv
    rrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvpa
    sapfyirrlstiflekrggegvfrefvekvlginledfiavi