PDB entry 4hgn

View 4hgn on RCSB PDB site
Description: Crystal Structure of 2-keto-3-deoxyoctulosonate 8-phosphate PHOSPHOHYDROLASE from Bacteroides thetaiotaomicron
Class: hydrolase
Keywords: Rossmann Fold, Phosphohydroylase, HYDROLASE
Deposited on 2012-10-08, released 2013-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydrolase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hgna_
  • Chain 'B':
    Compound: 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydrolase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hgnb_
  • Chain 'C':
    Compound: 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydrolase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hgnc_
  • Chain 'D':
    Compound: 2-keto-3-deoxy-D-manno-octulosonate 8-phosphate phosphohydrolase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hgnd_
  • Heterogens: MG, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hgnA (A:)
    gshmstinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhi
    aiitggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdiev
    mrecglpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwmaedafgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgnA (A:)
    stinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhiaiit
    ggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdievmrec
    glpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hgnB (B:)
    gshmstinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhi
    aiitggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdiev
    mrecglpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwmaedafgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgnB (B:)
    stinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhiaiit
    ggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdievmrec
    glpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hgnC (C:)
    gshmstinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhi
    aiitggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdiev
    mrecglpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwmaedafgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgnC (C:)
    stinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhiaiit
    ggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdievmrec
    glpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hgnD (D:)
    gshmstinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhi
    aiitggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdiev
    mrecglpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwmaedafgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hgnD (D:)
    stinydlsrikalafdvdgvlssttvplhpsgepmrtvnikdgyaiqlavkkglhiaiit
    ggrteavrirfaalgvkdlymgsavkihdyrnfrdkyglsddeilymgddvpdievmrec
    glpccpkdavpevksvakyisyadggrgcgrdvveqvlkahgkwm