PDB entry 4hg9

View 4hg9 on RCSB PDB site
Description: Crystal structure of AhV_bPA, a basic PLA2 from Agkistrodon halys pallas venom
Class: hydrolase
Keywords: alpha-helix, glycerophospholipid, venom gland, HYDROLASE
Deposited on 2012-10-07, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 B
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • conflict (0)
      • conflict (53)
      • conflict (69)
      • conflict (71)
      • conflict (108)
      • conflict (111)
    Domains in SCOPe 2.07: d4hg9a_
  • Chain 'B':
    Compound: Basic phospholipase A2 B
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • conflict (0)
      • conflict (53)
      • conflict (69)
      • conflict (71)
      • conflict (108)
      • conflict (111)
    Domains in SCOPe 2.07: d4hg9b_
  • Chain 'C':
    Compound: Basic phospholipase A2 B
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • conflict (0)
      • conflict (53)
      • conflict (69)
      • conflict (71)
      • conflict (108)
      • conflict (111)
    Domains in SCOPe 2.07: d4hg9c_
  • Chain 'D':
    Compound: Basic phospholipase A2 B
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • conflict (0)
      • conflict (53)
      • conflict (69)
      • conflict (71)
      • conflict (108)
      • conflict (111)
    Domains in SCOPe 2.07: d4hg9d_
  • Heterogens: CA, CIT, G3P, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hg9A (A:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkdgdivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hg9B (B:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkdgdivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hg9C (C:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkdgdivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hg9D (D:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkdgdivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc