PDB entry 4hg7

View 4hg7 on RCSB PDB site
Description: Crystal Structure of an MDM2/Nutlin-3a complex
Class: ligase
Keywords: MDM2, Nutlin-3a, Surface Entropy Reduction, Mutant Validation, LIGASE
Deposited on 2012-10-07, released 2013-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (Start-96)
      • engineered mutation (57-58)
    Domains in SCOPe 2.07: d4hg7a_
  • Heterogens: NUT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hg7A (A:)
    gplgssqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydaaq
    qhivycsndllgdlfgvpsfsvkehrkiytmiyrnlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hg7A (A:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydaaqqhivyc
    sndllgdlfgvpsfsvkehrkiytmiyrnlv