PDB entry 4hf8

View 4hf8 on RCSB PDB site
Description: Crystal structure of L-methionine gamma-lyase from Citrobacter freundii with glycine
Class: lyase
Keywords: complex, PYRIDOXAL-5'-PHOSPHATE, PLP-DEPENDENT ENZYME, Lyase, L-methionine
Deposited on 2012-10-05, released 2013-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: megL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84AR1
      • conflict (132)
      • conflict (136)
    Domains in SCOPe 2.08: d4hf8a_
  • Heterogens: PLG, GLY, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hf8A (A:)
    msdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytr
    lgnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafl
    shsmpkfginvrfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqga
    llvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkd
    itggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqye
    lgqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvap
    eerlkagitdglirlsvgledpediindlehairkatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hf8A (A:)
    sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
    gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
    hsmpkfginvrfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
    lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
    tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
    gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
    erlkagitdglirlsvgledpediindlehairkat