PDB entry 4hf5

View 4hf5 on RCSB PDB site
Description: Crystal structure of Fab 8F8 in complex a H2N2 influenza virus hemagglutinin
Class: viral protein/immune system
Keywords: VIRAL PROTEIN/IMMUNE SYSTEM, hemagglutinin, antibody, viral receptor binding, antigen binding, sialic acid, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-10-04, released 2013-02-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.232
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:382813]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7S226 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.05: d4hf5a_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:382813]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hf5b_
  • Chain 'H':
    Compound: Fab 8F8 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HF5 (0-End)
  • Chain 'L':
    Compound: Fab 8F8 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HF5
    Domains in SCOPe 2.05: d4hf5l1, d4hf5l2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hf5A (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hf5A (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hf5B (B:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
    tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrneik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hf5B (B:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
    tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hf5L (L:)
    qsvltqspsasgtpgqaitiscsgsssnigsnpvnwyqqlpgaapklliyadehrpsgvp
    drfsgsksgtsaslaisglqsedeadyycaawddslsgpavvfgggtkltvlgqpkaaps
    vtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaa
    ssylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hf5L (L:)
    vltqspsasgtpgqaitiscsgsssnigsnpvnwyqqlpgaapklliyadehrpsgvpdr
    fsgsksgtsaslaisglqsedeadyycaawddslsgpavvfgggtkltvlgqpkaapsvt
    lfppsseelqlvclisdfypgavtvgvetttpskqsnnkyaassylsltpeqwkshrsys
    cqvthegstvektvap