PDB entry 4hem

View 4hem on RCSB PDB site
Description: Llama vHH-02 binder of ORF49 (RBP) from lactococcal phage TP901-1
Class: viral protein
Keywords: Alpha-beta, Phage Receptor Binding Protein, Llama vHH, viral protein, CELL ADHESION-IMMUNE SYSTEM complex
Deposited on 2012-10-04, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hema1
  • Chain 'B':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hemb1
  • Chain 'C':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hemc1
  • Chain 'E':
    Compound: Anti-baseplate TP901-1 Llama vHH 02
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HEM (0-122)
    Domains in SCOPe 2.07: d4heme_
  • Chain 'F':
    Compound: Anti-baseplate TP901-1 Llama vHH 02
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HEM (0-End)
    Domains in SCOPe 2.07: d4hemf_
  • Chain 'G':
    Compound: Anti-baseplate TP901-1 Llama vHH 02
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HEM (0-122)
    Domains in SCOPe 2.07: d4hemg_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hemA (A:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hemA (A:)
    nvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysigge
    isssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptassgt
    prgtgtypid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hemB (B:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hemB (B:)
    nvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysigge
    isssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptassgt
    prgtgtypid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hemC (C:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hemC (C:)
    gnvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysigg
    eisssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptassg
    tprgtgtypid
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4hemE (E:)
    qvqlvesggglvqaggslrlscaasestfsnyamgwfrqapgperefvatisqtgshtyy
    rnsvkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hemE (E:)
    qvqlvesggglvqaggslrlscaasestfsnyamgwfrqaperefvatisqtgshtyyrn
    svkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvtvs
    s
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4hemF (F:)
    qvqlvesggglvqaggslrlscaasestfsnyamgwfrqapgperefvatisqtgshtyy
    rnsvkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hemF (F:)
    qvqlvesggglvqaggslrlscaasestfsnyamgwfrqapgperefvatisqtgshtyy
    rnsvkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvt
    vs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4hemG (G:)
    qvqlvesggglvqaggslrlscaasestfsnyamgwfrqapgperefvatisqtgshtyy
    rnsvkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hemG (G:)
    qvqlvesggglvqaggslrlscaasestfsnyamgwfrqaperefvatisqtgshtyyrn
    svkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvtvs
    s