PDB entry 4heb

View 4heb on RCSB PDB site
Description: The Crystal structure of Maf protein of Bacillus subtilis
Class: cell cycle
Keywords: Bacillus subtilis, Maf proteins, nucleoside triphosphate pyrophosphatase, Structural Genomics, Structural Genomics Consortium, SGC, CELL CYCLE
Deposited on 2012-10-03, released 2012-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Septum formation protein Maf
    Species: Bacillus subtilis [TaxId:1423]
    Gene: maf, BSU28050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4heba_
  • Chain 'B':
    Compound: Septum formation protein Maf
    Species: Bacillus subtilis [TaxId:1423]
    Gene: maf, BSU28050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hebb_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hebA (A:)
    mgsshhhhhhssgrenlyfqgmtkplilasqsprrkelldllqlpysiivseveeklnrn
    fspeenvqwlakqkakavadlhphaivigadtmvcldgeclgkpqdqeeaasmlrrlsgr
    shsvitavsiqaenhsetfydktevafwslseeeiwtyietkepmdkagaygiqgrgalf
    vkkidgdyysvmglpisktmralrhfdira
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hebA (A:)
    kplilasqsprrkelldllqlpysiivseveklnrnfspeenvqwlakqkakavadlhph
    aivigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydkte
    vafwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmralr
    hf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hebB (B:)
    mgsshhhhhhssgrenlyfqgmtkplilasqsprrkelldllqlpysiivseveeklnrn
    fspeenvqwlakqkakavadlhphaivigadtmvcldgeclgkpqdqeeaasmlrrlsgr
    shsvitavsiqaenhsetfydktevafwslseeeiwtyietkepmdkagaygiqgrgalf
    vkkidgdyysvmglpisktmralrhfdira
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hebB (B:)
    tkplilasqsprrkelldllqlpysiivsevnrnfspeenvqwlakqkakavadlhphai
    vigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydkteva
    fwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmralrhf
    dir